Protein coding transcript 197043

• Transcript: Ll_transcript_64993
• CDS coordinates: 719-1492 (+)
• Peptide sequence: MQREIFQKLVRKLEKHCENVLIGSEIDYRRFIAQRSMNQIEGENNRSPRIGSYFWPIEMDAINKFEEKWHDVTSRLGGRIVSNTISVMFGRTLEVPESCEGVARFTFEYLCGRPLGAADYIAVAENYHTVFISDIPMMSMRIRDKARRFITLIDELYNRHCCLCCLASSSVDELFQGTEEGTLFDLESFQFETETEGAKLRRDVLAEGNVGSGGGPVGITSILSGQEEMFAFQRAVSRLIEMQTPLYLDGISNFHPFF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_64993

• Blastp: AFG1-like ATPase from Mus with 32.79% of identity
• Blastx: AFG1-like ATPase from Mus with 33.06% of identity
• Eggnog: AFG1 family ATPase(COG1485)
• Kegg: Link to kegg annotations (215951)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447543.1)
• Pfam: AFG1-like ATPase (PF03969.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;