Protein coding transcript 197073

• Transcript: Ll_transcript_65123
• CDS coordinates: 603-1130 (+)
• Peptide sequence: MQASSIFSAKLPISSGVKKGSINMATAPKWAQKTITLPPHKRGCHLVTSKIVREIEHDLSGFNCGLAHLFLQHTSASLTINENYDSDVRDDTETFLNRVVPEGSSAPWKHTLEGPDDMPAHIKSSMFGCALTIPITNGKLNMGTWQVTNFIFLTIYPKYSWSGLIMKILSCVELL*
• ORF Type: complete

Annotations of Ll_transcript_65123

• Blastp: UPF0047 protein C4A8.02c from Schizosaccharomyces with 51.3% of identity
• Blastx: UPF0047 protein C4A8.02c from Schizosaccharomyces with 51.3% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC4A8.02c)
• CantataDB: Link to cantataDB annotations (CNT0001138)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445858.1)
• Pfam: Uncharacterised protein family UPF0047 (PF01894.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;