Protein coding transcript 197074

• Transcript: Ll_transcript_65124
• CDS coordinates: 603-1112 (+)
• Peptide sequence: MQASSIFSAKLPISSGVKKGSINMATAPKWAQKTITLPPHKRGCHLVTSKIVREIEHDLSGFNCGLAHLFLQHTSASLTINENYDSDVRDDTETFLNRVVPEGSSAPWKHTLEGPDDMPAHIKSSMFGCALTIPITNGKLNMGTWQGIWLCEHRDHPSSRRVVVTLNGI*
• ORF Type: complete

Annotations of Ll_transcript_65124

• Blastp: UPF0047 protein YjbQ from Escherichia with 53.96% of identity
• Blastx: UPF0047 protein YjbQ from Escherichia with 53.96% of identity
• Eggnog: Secondary thiamine-phosphate synthase enzyme(COG0432)
• Kegg: Link to kegg annotations (JW4017)
• CantataDB: Link to cantataDB annotations (CNT0001138)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445858.1)
• Pfam: Uncharacterised protein family UPF0047 (PF01894.16)
• Rfam: -
• GO: -