Transcript | Ll_transcript_63215 |
---|---|
CDS coordinates | 36-416 (+) |
Peptide sequence | MKVNIPNQQGIVVQGGGGRRRMRLVMLVLILIFYGARGKESERVIHAKGNPDSVVWVVQLSDIHFSVHHPDRAHDFDKYVGPALKTINPSLILITGDLTGAHTRFQFSIQCLLGRQGCKAVSSIGN* |
ORF Type | complete |
Blastp | Putative metallophosphoesterase At3g03305 from Arabidopsis with 60% of identity |
---|---|
Blastx | Putative metallophosphoesterase At3g03305 from Arabidopsis with 55.26% of identity |
Eggnog | transmembrane protein 62(ENOG410XNV4) |
Kegg | Link to kegg annotations (AT3G03305) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449971.1) |
Pfam | Calcineurin-like phosphoesterase (PF00149.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer