Protein coding transcript 197090

• Transcript: Ll_transcript_63215
• CDS coordinates: 36-416 (+)
• Peptide sequence: MKVNIPNQQGIVVQGGGGRRRMRLVMLVLILIFYGARGKESERVIHAKGNPDSVVWVVQLSDIHFSVHHPDRAHDFDKYVGPALKTINPSLILITGDLTGAHTRFQFSIQCLLGRQGCKAVSSIGN*
• ORF Type: complete

Annotations of Ll_transcript_63215

• Blastp: Putative metallophosphoesterase At3g03305 from Arabidopsis with 60% of identity
• Blastx: Putative metallophosphoesterase At3g03305 from Arabidopsis with 55.26% of identity
• Eggnog: transmembrane protein 62(ENOG410XNV4)
• Kegg: Link to kegg annotations (AT3G03305)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449971.1)
• Pfam: Calcineurin-like phosphoesterase (PF00149.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;