| Transcript | Ll_transcript_64024 |
|---|---|
| CDS coordinates | 174-602 (+) |
| Peptide sequence | MEEAPKVIAHQIGGLQNDAFRFGLQGVKSDIVGSHPLQSASQSASRTNELMKRQCMVNLYGTAFPLKMDLDRQILSRFQRPPGAIPSSMLGLEAVTGDLDNFGFEDYLNDPRESDSLRPLDMHHGMEVRLGLSKGPVCPSFI* |
| ORF Type | complete |
| Blastp | Cyclin-B1-2 from Oryza sativa with 50.91% of identity |
|---|---|
| Blastx | Cyclin-B1-2 from Oryza sativa with 52.88% of identity |
| Eggnog | epimerase dehydratase(COG0702) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019423547.1) |
| Pfam | Proteasome maturation factor UMP1 (PF05348.10) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer