Protein coding transcript 1972

• Transcript: Ll_transcript_355487
• CDS coordinates: 151-489 (+)
• Peptide sequence: MQAIRKGLEKVQNEQSSSENDGPISQTFCKNSKEFLCSAEAEVSSLASLYSVVGGNVDALIIYFGEDPNRCPLEQVVTTLLNFTGMFNKANEENHNQLELEMKKTEESATKK*
• ORF Type: complete

Annotations of Ll_transcript_355487

• Blastp: Formin-like protein 13 from Arabidopsis with 71.15% of identity
• Blastx: Formin-like protein 13 from Arabidopsis with 72.26% of identity
• Eggnog: actin cytoskeleton organization(ENOG410XT5Z)
• Kegg: Link to kegg annotations (AT5G58160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414354.1)
• Pfam: Formin Homology 2 Domain (PF02181.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;