Protein coding transcript 197256

• Transcript: Ll_transcript_65269
• CDS coordinates: 642-1337 (+)
• Peptide sequence: MNDADKSKSKVGVAIGATAGAIVALAAIIGFVCFMVKRKKKIAASSKQSRSDDLFLPPSSNDDTFTSTTNMSQSVPSYISSKTDSVPPMRSFYFGVQVFTIAELEEATDNFNPSREIGEGGFGTVYKGELKDGRVVAVKRHFESNFKRVQQFMNEVEILAKLRHKNLVTLYGCTSRHSRELLLVYEFISNGTVADHLHGNRANSNFVSWPVRLNIAIETAEALAFLHASDVI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_65269

• Blastp: LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.3 from Arabidopsis with 52.14% of identity
• Blastx: LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.3 from Arabidopsis with 68.31% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G38210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413554.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;