Protein coding transcript 197295

• Transcript: Ll_transcript_64556
• CDS coordinates: 231-659 (+)
• Peptide sequence: MTELQTKPETAPAPTTAPVVDPQPLAEALPLAVVVDEKAVVPTAPVVPVEETKALVVVEKEKILDPVPVHKKGSLDRDIALAEVEKEKKLSYVKAWEESEKSKAENKAQKQLSAVAAWENSKKATLEAELKKIEVIHNLLLS*
• ORF Type: complete

Annotations of Ll_transcript_64556

• Blastp: Remorin from Solanum with 58.4% of identity
• Blastx: Remorin from Solanum with 67.9% of identity
• Eggnog: Remorin family(ENOG410YI71)
• Kegg: Link to kegg annotations (102577743)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413951.1)
• Pfam: Remorin, N-terminal region (PF03766.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;