Transcript | Ll_transcript_64566 |
---|---|
CDS coordinates | 3-323 (+) |
Peptide sequence | ILDPVPVHKKGSLDRDIALVVVEKEKILDPVPVHKKGSLDRDIALAEVEKEKKLSYVKAWEESEKSKAENKAQKQLSAVAAWENSKKATLEAELKKIEVIHNLLLS* |
ORF Type | 5prime_partial |
Blastp | Remorin from Solanum with 62.11% of identity |
---|---|
Blastx | Remorin from Solanum with 62.11% of identity |
Eggnog | Remorin family(ENOG410YI71) |
Kegg | Link to kegg annotations (102577743) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413951.1) |
Pfam | Remorin, N-terminal region (PF03766.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer