Protein coding transcript 197329

• Transcript: Ll_transcript_64141
• CDS coordinates: 1078-1857 (+)
• Peptide sequence: MKELDIEKTAFRTHEGHYEFVVMPFGLTNAPSTFQALMNEVLKPFLRRFVLVFFDDILVFSSNLELHCEHLQQVLEVMEVHSLKANRKKCTFAQGKLEYLGHIISAEGVQADQNKIEAMSSWPIRKDVKGLRGFLGLTGYYRRFVKDYGKKTKPLTDLLKNDGFRWDEAASKAFQTLKATMIDLPKLAVPDFTKVFIVETDASSNSLGAVLMQEGKPLAYWSQGLSIKAQQKSVYERKLMALIQVVQRWRHYLLGRHFII
• ORF Type: 3prime_partial

Annotations of Ll_transcript_64141

• Blastp: Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 43.35% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon 297 from Sophophora with 43.15% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002695)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442309.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;