Protein coding transcript 197433

• Transcript: Ll_transcript_63922
• CDS coordinates: 683-1111 (+)
• Peptide sequence: MIFNNMLVQVLLLGRLHHRNLVNLVGYCVDKGQHMLVYQFMSNGSLENLLYGKEKKLSWDQRLRIALDISHGIEYLHEGAVPPVIHRDLKSANILLDHSMGAKVADFGLSKEEVFDGRNSGLKGTYGYMDPAYISTSKLTTNS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_63922

• Blastp: Calcium/calmodulin-regulated receptor-like kinase 2 from Arabidopsis with 78.26% of identity
• Blastx: Calcium/calmodulin-regulated receptor-like kinase 2 from Arabidopsis with 78.26% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G15730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442768.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;