Protein coding transcript 197511

• Transcript: Ll_transcript_64328
• CDS coordinates: 1236-1643 (+)
• Peptide sequence: MSCPAMAQLLSNTLYYKRFFPYYAFNVLGGLDNEGKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAIALVKTVFASATERDIYTGDKLEIVTLNASGIHREYMDLRKD*
• ORF Type: complete

Annotations of Ll_transcript_64328

• Blastp: Proteasome subunit beta type-1 from Petunia with 92.59% of identity
• Blastx: Proteasome subunit beta type-1 from Petunia with 93.06% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433633.1)
• Pfam: Proteasome subunit (PF00227.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;