Protein coding transcript 197604

• Transcript: Ll_transcript_64861
• CDS coordinates: 254-730 (+)
• Peptide sequence: MDDFLKDFFPDVYERKHAHLTETDYCKYDDQILTLFTSSLYFAALISTFGASSLTKTKGRRASIIVGSISFFMGAVLNASAVNISMLIIGRILLGFGIGFGNQVSSILTYSFSIGYHILYHFFDTKGSISYSFITGITSYFSFVVFSSTPFHETRLFF*
• ORF Type: complete

Annotations of Ll_transcript_64861

• Blastp: Sugar transport protein 14 from Arabidopsis with 74.76% of identity
• Blastx: Sugar transport protein 14 from Arabidopsis with 75.45% of identity
• Eggnog: Transporter(ENOG410XNQK)
• Kegg: Link to kegg annotations (AT1G77210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429202.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;