Protein coding transcript 197616

• Transcript: Ll_transcript_64871
• CDS coordinates: 426-839 (+)
• Peptide sequence: MKIVKGIGLAEAKVGVNKPELLPQKFTTVIDVAGFLSDGQEKRLAQEIIDLEKDTGFKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGNILNFNVGASVDLDIPRSFWSRLAGKYGNIFYWKEKVELVFQE*
• ORF Type: complete

Annotations of Ll_transcript_64871

• Blastp: Thylakoid lumenal 15.0 kDa protein 2, chloroplastic from Arabidopsis with 86.05% of identity
• Blastx: Thylakoid lumenal 15.0 kDa protein 2, chloroplastic from Arabidopsis with 86.05% of identity
• Eggnog: 15.0 kDa protein(ENOG410XR27)
• Kegg: Link to kegg annotations (AT5G52970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443072.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;