Protein coding transcript 197624

• Transcript: Ll_transcript_64885
• CDS coordinates: 3-377 (+)
• Peptide sequence: RLSAMATRVAARFASRRLFSSGTGKVLGEEEKAAENAYFKKAEQEKLEKLARKGPQPEATAAAGSGGSVADAKPSGSAYTNTSAHKVSTDKNRNYAVLAGTITALSALGWYLKGTAKKPEEVQD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_64885

• Blastp: Uncharacterized protein At2g27730, mitochondrial from Arabidopsis with 57.5% of identity
• Blastx: Uncharacterized protein At2g27730, mitochondrial from Arabidopsis with 57.5% of identity
• Eggnog: NA(ENOG410Y847)
• Kegg: Link to kegg annotations (AT2G27730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448845.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;