Transcript | Ll_transcript_64897 |
---|---|
CDS coordinates | 138-497 (+) |
Peptide sequence | MATRLAGRFAPRRLFSSGTGKVLGEEEKAAENAYFKKAEQEKLEKLARKGPQSEATTASGPGGSVADAKPSASGSTNTSAHKVSTDKNRNYAVLAGTITFLGALGWYYKGTAKKPEVQD* |
ORF Type | complete |
Blastp | Uncharacterized protein At2g27730, mitochondrial from Arabidopsis with 56.67% of identity |
---|---|
Blastx | Uncharacterized protein At2g27730, mitochondrial from Arabidopsis with 56.48% of identity |
Eggnog | NA(ENOG410Y847) |
Kegg | Link to kegg annotations (AT2G27730) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413418.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer