| Transcript | Ll_transcript_109803 |
|---|---|
| CDS coordinates | 3-518 (+) |
| Peptide sequence | GGYNSSTVGIELTRAELSQLETIINNASPSSPISELTEAKGLSLHCGKRKQDRGTMCSLESSLTSSESCGRKKEKNPMEFNTTSLELPLVDIKHEVKGSNGGSSNGEASGRKRSGATDSDGSCVEQPCGKRCGNKLKKPMLLELIDLNNQYESDMDSGSKTTLDLNCSSSF* |
| ORF Type | 5prime_partial |
| Blastp | Myb family transcription factor PHL8 from Arabidopsis with 35.47% of identity |
|---|---|
| Blastx | - |
| Eggnog | Myb-like DNA-binding domain(ENOG4111ACN) |
| Kegg | Link to kegg annotations (AT1G69580) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019459045.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer