Protein coding transcript 197797

• Transcript: Ll_transcript_109807
• CDS coordinates: 402-728 (+)
• Peptide sequence: MDQQNKQNQSVHFVLSTDAKPRLKWTPELHQRFIYATNQLGGPEKATPKSLMRVMGIPGLTLYHLKSHLQKYRLGKNQQPETCSENKQQGELKYIYFNVNSMIGLFLS*
• ORF Type: complete

Annotations of Ll_transcript_109807

• Blastp: Myb-related protein 2 from Arabidopsis with 81.54% of identity
• Blastx: Myb-related protein 2 from Arabidopsis with 81.54% of identity
• Eggnog: Transcription factor(ENOG410Y9RE)
• Kegg: Link to kegg annotations (AT3G04030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455710.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;