Transcript | Ll_transcript_112753 |
---|---|
CDS coordinates | 610-1308 (+) |
Peptide sequence | MSMLFFVRLNIKDAILDGGIDLFNKVHGITMWENMEKDTKLNQTFNKAMSGMSAVQMRKYLEVYDGFQGISTLVDVGGGTGQCLKMILSKYPNIKGINFDLPQVIQHALPYPGIEHVGGSMHESVPRGDAIMIKATCHNWSDETCITILKNCYKALPEDGKVIILDMIMPEEIDSSDATKYVSIIDNTMFILAGGKERTEKEFEKLCKESGFSKSVVVCLALSVFGVIEFYK* |
ORF Type | complete |
Blastp | Isoliquiritigenin 2'-O-methyltransferase from Medicago with 60.26% of identity |
---|---|
Blastx | Isoliquiritigenin 2'-O-methyltransferase from Medicago with 59.66% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AAB48059) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459339.1) |
Pfam | O-methyltransferase (PF00891.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer