Protein coding transcript 197877

• Transcript: Ll_transcript_112765
• CDS coordinates: 661-1359 (+)
• Peptide sequence: MSMLFFVRLNIKDAILDGGIDLFNKVHGITMWENMEKDTKLNQTFNKAMSGMSAVQMRKYLEVYDGFQGISTLVDVGGGTGQCLKMILSKYPNIKGINFDLPQVIQHALPYPGIEHVGGSMHESVPRGDAIMIKATCHNWSDETCITILKNCYKALPEDGKVIILDMIMPEEIDSSDATKYVSIIDNTMFILAGGKERTEKEFEKLCKESGFSKSVVVCLALSVFGVIEFYK*
• ORF Type: complete

Annotations of Ll_transcript_112765

• Blastp: Isoliquiritigenin 2'-O-methyltransferase from Medicago with 60.26% of identity
• Blastx: Isoliquiritigenin 2'-O-methyltransferase from Medicago with 59.66% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAB48059)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459339.1)
• Pfam: O-methyltransferase (PF00891.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;