Protein coding transcript 1979

• Transcript: Ll_transcript_355476
• CDS coordinates: 76-570 (+)
• Peptide sequence: MEETKSRFKRICVYCGSSSGNKASYQEAAIELARELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHVLGIIPRSLMTKEITGDPVGEVIAVSDMHRRKAEMARHADAFIALPGGYGTLEELLEIITWAQLGIHSKPVGLLNVDGFYNSLLSFIDKAVDEGFISPK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_355476

• Blastp: Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG7 from Arabidopsis with 85.98% of identity
• Blastx: Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG7 from Arabidopsis with 85.98% of identity
• Eggnog: decarboxylase(COG1611)
• Kegg: Link to kegg annotations (AT5G06300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435081.1)
• Pfam: Possible lysine decarboxylase (PF03641.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;