Transcript | Ll_transcript_355478 |
---|---|
CDS coordinates | 141-542 (+) |
Peptide sequence | MSGVWVFEKNGVARLISNPTRESFEHKHTPHSSGTPTAPGARPRQLLFLPTNQVITSHSQLQHTLAQLGWTRYHNSDNPHLIQFHRSQNSTHLISLPKTFSDIKHFHMYDIVIKNPSFFQVRNPMSSVSKHQP* |
ORF Type | complete |
Blastp | Flowering-promoting factor 1-like protein 1 from Arabidopsis with 47.58% of identity |
---|---|
Blastx | Flowering-promoting factor 1-like protein 1 from Arabidopsis with 47.58% of identity |
Eggnog | positive regulation of flower development(ENOG4112CDX) |
Kegg | Link to kegg annotations (AT4G31380) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003542029.2) |
Pfam | - |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer