Protein coding transcript 198018

• Transcript: Ll_transcript_112393
• CDS coordinates: 1-432 (+)
• Peptide sequence: LLFGWGWNKCGQIGVGDNFDHSSPMQVNFPHEEKIVQISCGWRHNIAVTECENVYSWGRGANGQLGHGETIDRNVPMIIEALSVDGSCGQHIESSKAHPVSGKSSVSLSEIYAVVPDEAAKGQASHPDRGDKLDASVPESDVN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_112393

• Blastp: Ultraviolet-B receptor UVR8 from Arabidopsis with 62.68% of identity
• Blastx: Ultraviolet-B receptor UVR8 from Arabidopsis with 62.68% of identity
• Eggnog: regulator of chromosome condensation(COG5184)
• Kegg: Link to kegg annotations (AT5G63860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458700.1)
• Pfam: Regulator of chromosome condensation (RCC1) repeat (PF00415.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;