Transcript | Ll_transcript_112393 |
---|---|
CDS coordinates | 1-432 (+) |
Peptide sequence | LLFGWGWNKCGQIGVGDNFDHSSPMQVNFPHEEKIVQISCGWRHNIAVTECENVYSWGRGANGQLGHGETIDRNVPMIIEALSVDGSCGQHIESSKAHPVSGKSSVSLSEIYAVVPDEAAKGQASHPDRGDKLDASVPESDVN* |
ORF Type | 5prime_partial |
Blastp | Ultraviolet-B receptor UVR8 from Arabidopsis with 62.68% of identity |
---|---|
Blastx | Ultraviolet-B receptor UVR8 from Arabidopsis with 62.68% of identity |
Eggnog | regulator of chromosome condensation(COG5184) |
Kegg | Link to kegg annotations (AT5G63860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458700.1) |
Pfam | Regulator of chromosome condensation (RCC1) repeat (PF00415.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer