Protein coding transcript 198044

• Transcript: Ll_transcript_112067
• CDS coordinates: 186-662 (+)
• Peptide sequence: MLAMGTMNVIGSVTSCYVATGSFSRTAVNYMAGCKTVVSNIVMSITVLLTLILITPLFKYTPIVVLSSIIIVVVLGLVNIDVVILLWKIDKLDFVAFMGVFLGVIFKSADIGILIAVMKLSKAISNIFVSSICLTHGIKSHVPPLSWPTPMSLLLSAK*
• ORF Type: complete

Annotations of Ll_transcript_112067

• Blastp: High affinity sulfate transporter 1 from Stylosanthes with 75.21% of identity
• Blastx: High affinity sulfate transporter 1 from Stylosanthes with 74.83% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419720.1)
• Pfam: Sulfate permease family (PF00916.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;