| Transcript | Ll_transcript_112053 |
|---|---|
| CDS coordinates | 3-317 (+) |
| Peptide sequence | QVTRPRTTVLGKLHGTSVYRNIHQYPKASQIPGMLIIRVDSAIYFSNSNYIKERILRWLTDEDIQRTGSEFPRIQYLIIEMSPVTDIDTSGIHAFVELYKSLLKR |
| ORF Type | internal |
| Blastp | High affinity sulfate transporter 2 from Stylosanthes with 85.71% of identity |
|---|---|
| Blastx | High affinity sulfate transporter 2 from Stylosanthes with 85.71% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019422862.1) |
| Pfam | STAS domain (PF01740.20) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer