Transcript | Ll_transcript_112057 |
---|---|
CDS coordinates | 1-453 (+) |
Peptide sequence | VVLLLWKIDKFDFVAFMGAFFGVLFKSADIGILIAVVLSFAKIILQVTRPRTVVLGMVTGTSVYRNIQQYPETTQIPGMLIIRVDSAIYFSNSNYIKERILRCLADEDAERTGSELPRIKYLIVEMSPVNDIDTGGIHAFQELCNSLQKRE |
ORF Type | internal |
Blastp | High affinity sulfate transporter 2 from Stylosanthes with 79.33% of identity |
---|---|
Blastx | High affinity sulfate transporter 2 from Stylosanthes with 79.33% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419720.1) |
Pfam | STAS domain (PF01740.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer