Protein coding transcript 19817

• Transcript: Ll_transcript_417775
• CDS coordinates: 1292-1693 (+)
• Peptide sequence: MKKKGIRVPGIGHRIKNRDNKDKRVELLQKFARAHFPSVKYMEYAVEVETYTLTKANNVVLNVDGAIGSLFLDLLAGSGMFSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLRQPLYRHPWEDVLYTK*
• ORF Type: complete

Annotations of Ll_transcript_417775

• Blastp: ATP-citrate synthase beta chain protein 1 from Arabidopsis with 91.73% of identity
• Blastx: ATP-citrate synthase beta chain protein 2 from Arabidopsis with 78.42% of identity
• Eggnog: Succinyl-CoA ligase ADP-forming subunit alpha(COG0074)
• Kegg: Link to kegg annotations (AT3G06650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419112.1)
• Pfam: Citrate synthase, C-terminal domain (PF00285.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;