Transcript | Ll_transcript_110532 |
---|---|
CDS coordinates | 1258-1767 (+) |
Peptide sequence | MSKDHRPYCIKERKRIESLGGFVDDGYLNGLLGVTRALGNWHLEGMKEKSGRGGPLTAEPELKLVTLTKEDELLIIGSDGIWDVFRSQNAIDFARRRLQEHNDVKQCCKEIVEEALKRGATDNLTVVMVCFHSDPPPHMVVERARVRRSISAEGLQNLKCLLEGQNIVV* |
ORF Type | complete |
Blastp | Probable protein phosphatase 2C 27 from Oryza sativa with 72.29% of identity |
---|---|
Blastx | Probable protein phosphatase 2C 27 from Oryza sativa with 72.52% of identity |
Eggnog | Phosphatase(COG0631) |
Kegg | Link to kegg annotations (4331028) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463094.1) |
Pfam | Protein phosphatase 2C (PF00481.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer