Protein coding transcript 198188

• Transcript: Ll_transcript_111460
• CDS coordinates: 3-518 (+)
• Peptide sequence: EVDEDYIQDNFNLCGLSSQVPHYDYALDLILDVDSSHDEMLTKEENEEIESAAGILYGLIHVRYILTSKGMAAMLEKYKNYDFGRCPRAYCSGQPCLPVGLSDIPGSSTVKLYCPRCEDVYNPQSKYHNVDGAYFGTTFPNLFLMTYGHLKPQKPTQRYVPRVFGFKVHKP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_111460

• Blastp: Casein kinase II subunit beta-2 from Arabidopsis with 78.49% of identity
• Blastx: Casein kinase II subunit beta-2 from Arabidopsis with 78.49% of identity
• Eggnog: casein kinase ii(COG5041)
• Kegg: Link to kegg annotations (AT4G17640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421146.1)
• Pfam: Casein kinase II regulatory subunit (PF01214.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;