Protein coding transcript 19820

• Transcript: Ll_transcript_417787
• CDS coordinates: 2-304 (+)
• Peptide sequence: DLSFAIKSGKVRAPTHIISTISDDRGEEPCYAGVPMSSIIEKGYGVGDIISLLWFKRSLPRYCTQFIEVGYSILQRAFLEFFSPLVSKCIIKDPIARSET*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_417787

• Blastp: ATP-citrate synthase beta chain protein 1 from Arabidopsis with 92.75% of identity
• Blastx: ATP-citrate synthase beta chain protein 1 from Arabidopsis with 91.74% of identity
• Eggnog: Succinyl-CoA ligase ADP-forming subunit alpha(COG0074)
• Kegg: Link to kegg annotations (AT3G06650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014491600.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;