Protein coding transcript 198200

• Transcript: Ll_transcript_111476
• CDS coordinates: 735-1043 (+)
• Peptide sequence: MAVTLAMFQSIPGWWIWFYYICPVSWTLRGIITSQLGDVENIIVGPGFKGTVKEYLAFSLGYEHTVNGFSSVGLSVIVLIGFVLLFFGSFAVSVKVLNFQKR*
• ORF Type: complete

Annotations of Ll_transcript_111476

• Blastp: ABC transporter G family member 51 from Oryza sativa with 59.34% of identity
• Blastx: ABC transporter G family member 51 from Oryza sativa with 59.34% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456848.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;