Protein coding transcript 198349

• Transcript: Ll_transcript_112545
• CDS coordinates: 226-651 (+)
• Peptide sequence: MESFSFPILFFLISTLLAFASGSRDLAGEVLRLPSFEASRFLHDDNIQGTRWAILFAGSSGYWNYRHQADVCHAYQILRKGGLKDENIVVFMFDDIAFNEENPRPGVIINKPDGDDVYAGVPKVNYLLCFQHSIPYCYFNF*
• ORF Type: complete

Annotations of Ll_transcript_112545

• Blastp: Vacuolar-processing enzyme from Citrus with 64.66% of identity
• Blastx: Vacuolar-processing enzyme from Citrus with 70.69% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (102612763)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458606.1)
• Pfam: Peptidase C13 family (PF01650.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;