| Transcript | Ll_transcript_112549 |
|---|---|
| CDS coordinates | 2-325 (+) |
| Peptide sequence | FLQEDNSQGTRWAILFAGSSGYWNYRHQADVCHAYQILRKGGVKEENIIVFMFDDIAFDEENPRPGVIINKPDGDDVYEGVPKVNLSWFLPYHIQLLFQFSSLSIMN* |
| ORF Type | 5prime_partial |
| Blastp | Vacuolar-processing enzyme from Vicia with 83.75% of identity |
|---|---|
| Blastx | Vacuolar-processing enzyme from Vicia with 82.72% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019429530.1) |
| Pfam | Peptidase C13 family (PF01650.17) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer