Transcript | Ll_transcript_111896 |
---|---|
CDS coordinates | 1181-1633 (+) |
Peptide sequence | MQCLGAICGAGVVKGFQGNARYELFKGGANFVNPGYTKGDGLGAEIVGTFVLVYTVFSATDAKRNARDSHVPLLAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNRDLAWDDHWIFWVGPFIGAALAAVYHQIVIRVIPFKTRA* |
ORF Type | complete |
Blastp | Probable aquaporin PIP1-2 from Oryza sativa with 87.33% of identity |
---|---|
Blastx | Probable aquaporin PIP1-2 from Oryza sativa with 88.76% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (9270874) |
CantataDB | Link to cantataDB annotations (CNT0000345) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444664.1) |
Pfam | Major intrinsic protein (PF00230.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer