Protein coding transcript 198413

• Transcript: Ll_transcript_111896
• CDS coordinates: 1181-1633 (+)
• Peptide sequence: MQCLGAICGAGVVKGFQGNARYELFKGGANFVNPGYTKGDGLGAEIVGTFVLVYTVFSATDAKRNARDSHVPLLAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNRDLAWDDHWIFWVGPFIGAALAAVYHQIVIRVIPFKTRA*
• ORF Type: complete

Annotations of Ll_transcript_111896

• Blastp: Probable aquaporin PIP1-2 from Oryza sativa with 87.33% of identity
• Blastx: Probable aquaporin PIP1-2 from Oryza sativa with 88.76% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (9270874)
• CantataDB: Link to cantataDB annotations (CNT0000345)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444664.1)
• Pfam: Major intrinsic protein (PF00230.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;