Transcript | Ll_transcript_111904 |
---|---|
CDS coordinates | 2-466 (+) |
Peptide sequence | ESAGAISGAGLAKGFQKSYFDRYGGGANFVHSGYNKGTALGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGSAVIYNKEKIWDDHWISWVGPLIGAFVAAVYHQYILRAAAIKALGSFRSNN* |
ORF Type | 5prime_partial |
Blastp | Aquaporin PIP2-7 from Zea with 84.31% of identity |
---|---|
Blastx | Aquaporin PIP2-7 from Zea with 84.31% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0000345) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453971.1) |
Pfam | Major intrinsic protein (PF00230.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer