Protein coding transcript 198421

• Transcript: Ll_transcript_111815
• CDS coordinates: 3431-3877 (+)
• Peptide sequence: MESNDSYDMEDFAMPLQEYISHPAAGDLVHNGATFQVAGLTNNSYIAEAHKVRRCVQKYKILGKYVLQVAKKRLDDMLYVGLTEEHRESATMFANVVGSQVISQLNAPNGGLDIINKKEQGSFSDSDPDSSEHQVRRIFSRGNLVIEI*
• ORF Type: complete

Annotations of Ll_transcript_111815

• Blastp: Protein-tyrosine sulfotransferase from Arabidopsis with 57.35% of identity
• Blastx: Protein-tyrosine sulfotransferase from Arabidopsis with 53.64% of identity
• Eggnog: NA(ENOG4110S7Q)
• Kegg: Link to kegg annotations (AT1G08030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413494.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;