| Transcript | Ll_transcript_111836 |
|---|---|
| CDS coordinates | 2485-2820 (+) |
| Peptide sequence | MEDFAMPLKEYINHPAAGDVVHNGATFQVAGLTNNSYIAEAHEVRHCVQKYKILGKFVLQVAKKRLDDMLYVGLTEEHRESATMFANVVGAQVISQLNAPNSSLDIGDKIG* |
| ORF Type | complete |
| Blastp | Protein-tyrosine sulfotransferase from Arabidopsis with 67.92% of identity |
|---|---|
| Blastx | Protein-tyrosine sulfotransferase from Arabidopsis with 62.02% of identity |
| Eggnog | NA(ENOG4110S7Q) |
| Kegg | Link to kegg annotations (AT1G08030) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019453948.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer