Protein coding transcript 198439

• Transcript: Ll_transcript_111805
• CDS coordinates: 4219-4701 (+)
• Peptide sequence: MVERDTGRPRGFGFITFADRRGMEDAMKEMHGRELGDRAISVNKAQPKMGSDDADHGYRSSYSSGGRGSYRVGDRTGQDDCFKCGRPGHWARDCPMSGGGRGGGGLFSSRPRFGASGGLGDHLSNERDRYADDRYDGRRYGDGDRYDDRYGSHDRHTSDR*
• ORF Type: complete

Annotations of Ll_transcript_111805

• Blastp: Glycine-rich RNA-binding protein RZ1C from Arabidopsis with 52.51% of identity
• Blastx: Glycine-rich RNA-binding protein RZ1B from Arabidopsis with 59.78% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT5G04280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461494.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;