Protein coding transcript 198445

• Transcript: Ll_transcript_111845
• CDS coordinates: 148-993 (+)
• Peptide sequence: MDHNTLKFCTLLILVGLLVNASFAKNDFGHCERVVKVWADSSLDEEIREDKHTLRDLLFFLHVPRTGGRTYFHCFLKKLYPSYLECPRSYDKLRFDPSKPKCKLLVTHDDYSMTSKLPRQRTSVVTILRDPIDRVFSTYEFSIEVASRFLVHPNLTSATRMAKHLRSKTKGVSTLDIWPWKYLVPWMREDLFARRGTRYSRGLHTMESNDSYDMEDFAMPLQEYISHPAAGDLVHNGATFQVAGLTNNSYIAEAHKVRRCVQKYKILGKYVLQVAKKRLDDM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_111845

• Blastp: Protein-tyrosine sulfotransferase from Arabidopsis with 68.05% of identity
• Blastx: Protein-tyrosine sulfotransferase from Arabidopsis with 68.05% of identity
• Eggnog: NA(ENOG4110S7Q)
• Kegg: Link to kegg annotations (AT1G08030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413491.1)
• Pfam: Sulfotransferase family (PF03567.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;