Protein coding transcript 198468

• Transcript: Ll_transcript_112165
• CDS coordinates: 84-461 (+)
• Peptide sequence: MAPTQIATVGALSVKVAQGSLGRAFVTFLAGNGDYWKGVVGLAKGLRKVNSAYPLVVAMLPDVPEEHREILINQGCVLREIVPVYPPENQTQFAMAYYVINYSKLRIWEVYIHILHISLSILFYV*
• ORF Type: complete

Annotations of Ll_transcript_112165

• Blastp: Galactinol synthase 1 from Arabidopsis with 66.92% of identity
• Blastx: Galactinol synthase 1 from Arabidopsis with 74.14% of identity
• Eggnog: Glycosyl Transferase(COG5597)
• Kegg: Link to kegg annotations (AT2G47180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426974.1)
• Pfam: Glycosyl transferase family 8 (PF01501.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;