Protein coding transcript 198482

• Transcript: Ll_transcript_112438
• CDS coordinates: 107-574 (+)
• Peptide sequence: MSEGYWRYGEPRPPPSSVAGKRSRNEYDASGIHDLASYYPHDDERGGLRAIRDTESLEASYERYLHSAQVPSYGAGQSTRTIGTRIPSHSVDDSHVTSIGGGVDPGKDKILGLGSGRPDHSLPHDATNTLFVEGLPPDCTRREVARILSSGFLYF*
• ORF Type: complete

Annotations of Ll_transcript_112438

• Blastp: RNA-binding protein 2 from Medicago with 31.4% of identity
• Blastx: RNA-binding protein 2 from Medicago with 36.89% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_1g099190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415239.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;