| Transcript | Ll_transcript_112432 |
|---|---|
| CDS coordinates | 205-672 (+) |
| Peptide sequence | MSEGYWRYGEPRHAPSSVAGKRSRNDYDASGVHDLASYYPHDHDRGAIQAIRDTETLEASYERYLRSAQVSSYGAEQSTRTHDGRTPSYSVDDSHVTSIGGGVDPGKDKILGLGSGRPDHSLPHDATNTLFVEGLPPDCTRREVARILSSGFLYF* |
| ORF Type | complete |
| Blastp | RNA-binding protein 2 from Medicago with 29.65% of identity |
|---|---|
| Blastx | RNA-binding protein 2 from Medicago with 35.39% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (MTR_1g099190) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019417873.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer