| Transcript | Ll_transcript_110447 |
|---|---|
| CDS coordinates | 2535-2891 (+) |
| Peptide sequence | MVVLDSNGKVTNNNALDMVKIWGARSFPFSASKEAELWQDQKLTMQLLLSDINPLLAYWVKEGKNICIYGSENLAWIQQFNDNITQLKKTGLQLETIYVGNNQLSEQHIKEIMTTTTAK |
| ORF Type | 3prime_partial |
| Blastp | Protein SIEVE ELEMENT OCCLUSION C from Arabidopsis with 45.05% of identity |
|---|---|
| Blastx | Protein SIEVE ELEMENT OCCLUSION C from Arabidopsis with 42.21% of identity |
| Eggnog | NA(ENOG411157J) |
| Kegg | Link to kegg annotations (AT1G67790) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019417028.1) |
| Pfam | Sieve element occlusion C-terminus (PF14577.5) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer