Protein coding transcript 198500

• Transcript: Ll_transcript_110448
• CDS coordinates: 741-1451 (+)
• Peptide sequence: MNSILVYINISPSSKFLCYDFNLLLLFQVASNIYTAPFSKNDITDQIELLGCPEPIGCIIKQISCKILCKCSGEGDLKSRIMSLFDLIGNYRWDAKVVLVLGAFAIRYGEFWNLIQLYPCDTLAASVMRLKQVPYKLRVLKPQIKALSLLVKTMMDVALCIIKFESMPLQHVELGNDVLIVTKSLMYLSVYWIIRSSLTCFSQVAEFSTKKHEQVHVLSLETYTPIISSTYNCFQY*
• ORF Type: complete

Annotations of Ll_transcript_110448

• Blastp: Protein SIEVE ELEMENT OCCLUSION C from Arabidopsis with 37.21% of identity
• Blastx: Protein SIEVE ELEMENT OCCLUSION C from Arabidopsis with 42.21% of identity
• Eggnog: NA(ENOG411157J)
• Kegg: Link to kegg annotations (AT1G67790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417028.1)
• Pfam: Sieve element occlusion N-terminus (PF14576.5)
• Rfam: -
• GO: -