| Transcript | Ll_transcript_110457 |
|---|---|
| CDS coordinates | 304-639 (+) |
| Peptide sequence | MSVPVIMYFLKLEEIEVKQVENNEGTLERTNRKSLNDTNEEKAIVFYKPNAEPPEAKGSLNRVHDLKVLETRKSVLQKEQGMAFARAVAAGFDIDHITALMSFSECFKHFG* |
| ORF Type | complete |
| Blastp | COP1-interacting protein 7 from Arabidopsis with 51.22% of identity |
|---|---|
| Blastx | - |
| Eggnog | NA(ENOG4111427) |
| Kegg | Link to kegg annotations (AT4G27430) |
| CantataDB | Link to cantataDB annotations (CNT0000925) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019427873.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer