Protein coding transcript 198566

• Transcript: Ll_transcript_111592
• CDS coordinates: 1-618 (+)
• Peptide sequence: LRKILCCLLNHMAEFTEDFQSFIDPSMELINQFIGMNPHALDNSHVNMQNLMMPFSGGSFFGSQEHEFQGNLEGNFQGLVNNALQVSLPIFPAENEIHEVKRRKIMDTHTTPETSSANSTPAASESGGKIRNNSEGVKRPKNHVTEEEKPKEVVHVRARRGQATDSHSIAERVRRGKINDKLRCLQNIVPGCYKVKAFFLCKTSV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_111592

• Blastp: Transcription factor BEE 3 from Arabidopsis with 40% of identity
• Blastx: Transcription factor BEE 3 from Arabidopsis with 40% of identity
• Eggnog: Transcription factor(ENOG410YIJY)
• Kegg: Link to kegg annotations (AT1G73830)
• CantataDB: Link to cantataDB annotations (CNT0001054)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457466.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;