Protein coding transcript 198575

• Transcript: Ll_transcript_111610
• CDS coordinates: 577-1011 (+)
• Peptide sequence: MREMLEANGQDSSGSELDLRDRCADGMMFGGLGNCPICDGFLRYSGGMYRCTGFSSEWSKCSYSTSEPQRLDGKWKIPVETTNEFLKKWFKSQKGKKPVRILPLQSPKKPMDGQTSASKHQSSNSESLRDLKFSICGLPKDSIV*
• ORF Type: complete

Annotations of Ll_transcript_111610

• Blastp: Poly [ADP-ribose] polymerase 1 from Oryza sativa with 57.34% of identity
• Blastx: Poly [ADP-ribose] polymerase 1 from Arabidopsis with 50.66% of identity
• Eggnog: Poly (ADP-ribose) polymerase(ENOG410XP18)
• Kegg: Link to kegg annotations (4343013)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456537.1)
• Pfam: PADR1 (NUC008) domain (PF08063.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;