Protein coding transcript 19860

• Transcript: Ll_transcript_418074
• CDS coordinates: 63-740 (+)
• Peptide sequence: MAEHETLFGTKPSPSESGKKASRCSIGFTSIRKSSIGGAMLQDQRHALLQKSNKKGSIPNHKGSILRNKNACHATQLSGRKDTSKISRHSTKTTMCSAEKEIQIQTPFTRKPLSPVSPSVLSKANINSHDDHKKIPKMSQKGQMLTRIPPSKPVNVGDEENRTPKNMGLPIPTTPLTSFPMLNATTPETPSSYSSSIIAAKNAQPLEYSFEEVRSGFILPKTYAN*
• ORF Type: complete

Annotations of Ll_transcript_418074

• Blastp: 65-kDa microtubule-associated protein 3 from Arabidopsis with 34.19% of identity
• Blastx: 65-kDa microtubule-associated protein 3 from Arabidopsis with 33.33% of identity
• Eggnog: protein regulator of cytokinesis(ENOG410YZBK)
• Kegg: Link to kegg annotations (AT5G51600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432941.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;