Transcript | Ll_transcript_418074 |
---|---|
CDS coordinates | 63-740 (+) |
Peptide sequence | MAEHETLFGTKPSPSESGKKASRCSIGFTSIRKSSIGGAMLQDQRHALLQKSNKKGSIPNHKGSILRNKNACHATQLSGRKDTSKISRHSTKTTMCSAEKEIQIQTPFTRKPLSPVSPSVLSKANINSHDDHKKIPKMSQKGQMLTRIPPSKPVNVGDEENRTPKNMGLPIPTTPLTSFPMLNATTPETPSSYSSSIIAAKNAQPLEYSFEEVRSGFILPKTYAN* |
ORF Type | complete |
Blastp | 65-kDa microtubule-associated protein 3 from Arabidopsis with 34.19% of identity |
---|---|
Blastx | 65-kDa microtubule-associated protein 3 from Arabidopsis with 33.33% of identity |
Eggnog | protein regulator of cytokinesis(ENOG410YZBK) |
Kegg | Link to kegg annotations (AT5G51600) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432941.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer