Protein coding transcript 198612

• Transcript: Ll_transcript_111322
• CDS coordinates: 201-992 (+)
• Peptide sequence: MSVIDILTRVDSICNKYDKYDVEKLNDAKISGDDAFSRLYAAVDNDIAALIQKAEIASRDKGKASAVAINAEIRRTKARLLEEVPKIQRLAVKKVKGLSSQEFAARNDLALALPERIQAIPDGTPAVPKQTGGWLGAASESHPEIKFDSNGRLDDEFFQHSEQSSQFRQEYEMRRIKQDQGLDVIAEGLDTLKEMAHGMNEELDRQVPLMDEIDNKVDKASSDLKNTNVRLKHTVNQLRSSRNFCIDIILLIIILGIAAYLYK*
• ORF Type: complete

Annotations of Ll_transcript_111322

• Blastp: Syntaxin-71 from Arabidopsis with 72.14% of identity
• Blastx: Syntaxin-71 from Arabidopsis with 72.14% of identity
• Eggnog: syntaxin of plants(ENOG410XS1R)
• Kegg: Link to kegg annotations (AT3G09740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432277.1)
• Pfam: SNARE domain (PF05739.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;