Transcript | Ll_transcript_418080 |
---|---|
CDS coordinates | 247-744 (+) |
Peptide sequence | MIDALILKVTAWEKERGLEFLYDRSRLLTMLEDYSMLRQEKENEKQRQRDQRRLQGQLMAEHETLFGTKPSPSESGKKASRCSIGFTSIRKSSIGGAMLQDQRHALLQKSNKKGSIPNHKGSILRNKNACHATQLSGISFFLFCSMHASQLSGISFFLFCSMHASQ |
ORF Type | 3prime_partial |
Blastp | 65-kDa microtubule-associated protein 4 from Arabidopsis with 57.58% of identity |
---|---|
Blastx | 65-kDa microtubule-associated protein 4 from Arabidopsis with 58% of identity |
Eggnog | protein regulator of cytokinesis(ENOG410YZBK) |
Kegg | Link to kegg annotations (AT3G60840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432941.1) |
Pfam | Microtubule associated protein (MAP65/ASE1 family) (PF03999.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer